Antigen Card |
The is the antigen card for every antigen and all its information available in our database.
| gene ID | 386004560 |
| Strain | Mtb_RGTB423 |
| Protein ID | YP_005922839.1 |
| Description | phiRv1 phage protein [Mycobacterium tuberculosis RGTB423] |
| Sequence | MTAGAGGSPPTRRCPATEDRAPATVATPSSADPTASRAVSWWSVHEHVAP VLDAAGSWPMAGTPAWRQLDDADPRKWAAICDAARHWALRVETCQEAMAQ ASRDVSAAADWPGIAREIVRRRGVYIPRAGVA |
| B cell epitope (IEDB) | 0 |
| T cell epitope (IEDB) | 0 |
| MHC binder (IEDB) | 0 |
| Vaccine Target | Yes |
| B cell prediction (LBtope) | 20 |
| MHC class II prediction (Propred) | 5 |
| MHC class 1 prediction (Propred1) | 75 |
| CTL epitope prediction (CTLpred) | 21 |
| Prediction of interferon-gamma inducing peptides (IFNepitope) | 54 |
| Prediction of IL4 inducing peptides (IL4pred) | 92 |