Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID386005807
StrainMtb_RGTB423
Protein IDYP_005924086.1
Description polyketide synthase pks1 [Mycobacterium tuberculosis RGTB423]
Sequence MISARSAEALTAQAGRLMAHVQANPGLDPIDVGCSLASRSVFEHRAVVVG
ASREQLIAGLAGLAAGEPGAGVAVGQPGSVGKTVVVFPGQGAQRIGMGRE
LYGELPVFAQAFDAVADELDRHLRLPLRDVIWGADADLLDSTEFAQPALF
AVEVASFAVLRDWGVLPDFVMGHSVGELAAAHAAGVLTLADAAMLVVARG
RLMQALPAGGAMVAVAASEDEVEPLLGEGVGIAAINAPESVVISGAQAAA
NAIADRFAAQGRRVHQLAVSHAFHSPLMEPMLEEFARVAARVQAREPQLG
LVSNVTGELAGPDFGSAQYWVDHVRRPVRFADSARHLQTLGATHFIEAGP
GSGLTGSIEQSLAPAEAMVVSMLGKDRPELASALGAAGQVFTTGVPVQWS
AVFAGSGGRRVQLPTYAFQRRRFWETPGADGPADAAGLGLGATEHALLGA
VVERPDSDEVVLTGRLSLADQPWLADHVVNGVVLFPGAGFVELVIRAGDE
VGCALIEELVLAAPLVMHPGVGVQVQVVVGAADESGHRAVSVYSRGDQSQ
GWLLNAEGMLGVAAAETPMDLSVWPPEGAESVDISDGYAQLAERGYAYGP
AFQGLVAIWRRGSELFAEVVAPGEAGVAVDRMGMHPAVLDAVLHALGLAV
EKTQASTETRLPFCWRGVSLHAGGAGRVRARFASAGADAISVDVCDATGL
PVLTVRSLVTRPITAEQLRAAVTAAGGASDQGPLEVVWSPISVVSGGANG
SAPPAPVSWADFCAGSDGDASVVVWELESAGGQASSVVGSVYAATHTALE
VLQSWLGADRAATLVVLTHGGVGLAGEDISDLAAAAVWGMARSAQAENPG
RIVLIDTDAAVDASVLAGVGEPQLLVRGGTVHAPRLSPAPALLALPAAES
AWRLAAGGGGTLEDLVIRPCPEVQAPLQAGQVRVAVAAVGVNFRDVVAAL
GMYPGQAPPLGAEGAGVVLETGPEVTDLAVGDAVMGFLGGAGPLAVVDQQ
LVTRVPQGWSFAQAAAVPVVFLTAWYGLADLAEIKAGESVLIHAGTGGVG
MAAVQLARQWGVEVFVTASRGKWDTLRAMGFDDDHIGDSRTCEFEEKFLA
VTEGRGVDVVLDSLAGEFVDASLRLLVRGGRFLEMGKTDIRDAQEIAANY
PGVQYRAFDLSEAGPARMQEMLAEVRELFDTRELHRLPVTTWDVRCAPAA
FRFMSQARHIGKVVLTMPSALADRLADGTVVITGATGAVGGVLARHLVGA
YGVRHLVLASRRGDRAEGAAELAADLTEAGAKVQVVACDVADRAAVAGLF
AQLSREYPPVRGVIHAAGVLDDAVITSLTPDRIDTVLRAKVDAAWNLHQA
TSDLDLSMFALCSSIAATVGSPGQGNYSAANAFLDGLAAHRQAAGLAGIS
LAWGLWEQPGGMTAHLSSRDLARMSRSGLAPMSPAEAVELFDAALAIDHP
LAVATLLDRAALDARAQAGALPALFSGLARRPRRRQIDDTGDATSSKSAL
AQRLHGLAADEQLELLVGLVCLQAAAVLGRPSAAEGGAPDTEFGDLGFDS
FNWLWSYATASKPPPD
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)144
MHC class II prediction (Propred)202
MHC class 1 prediction (Propred1)1072
CTL epitope prediction (CTLpred)225
Prediction of interferon-gamma inducing peptides (IFNepitope)692
Prediction of IL4 inducing peptides (IL4pred)932