Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID386006240
StrainMtb_RGTB423
Protein IDYP_005924519.1
Description hypothetical protein MRGA423_21445 [Mycobacterium tuberculosis RGTB
Sequence MTILILTDNVHAHALAVDLQARHGDMDVYQSPIGQLPGVPRCDVAERVAE
IVERYDLVLSFHCKQRFPAALIDGVRCVNVHPGFNPYNRGWFPQVFSIID
GQKVGVTIHEIDDQLDHGPIIAQRECAIESWDSSGSVYAGLMDIERELVL
EHFDAIRDGSYTAKSPATEGNLNLKKDFEQLRRLDLNERGTFGHFLNRLR
ALTHDDFRNAWFVDASGRKVFVRVVLEPEKPAEA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)20
MHC class II prediction (Propred)40
MHC class 1 prediction (Propred1)149
CTL epitope prediction (CTLpred)45
Prediction of interferon-gamma inducing peptides (IFNepitope)75
Prediction of IL4 inducing peptides (IL4pred)194