Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID386006364
StrainMtb_RGTB423
Protein IDYP_005924643.1
Description lipid-transfer protein [Mycobacterium tuberculosis RGTB423]
Sequence MLSGQAAIVGIGATDFSKNSGRSELRLAAEAVLDALADAGLSPTDVDGLT
TFTMDTNTEIAVARAAGIGELTFFSKIHYGGGAACATVQHAAMAVATGVA
DVVVAYRAFNERSGMRFGQVQTRLTENADSTGVDNSFSYPHGLSTPAAQV
AMIARRYMHLSGATSRDFGAVSVADRKHAANNPKAYFYGKPITIEDHQNS
RWIAEPLRLLDCCQETDGAVAIVVTSAARARDLKQRPVVIEAAAQGCSPD
QYTMVSYYRPELDGLPEMGLVGRQLWAQSGLTPADVQTAVLYDHFTPFTL
IQLEELGFCGKGEAKDFIADGAIEVGGRLPINTHGGQLGEAYIHGMNGIA
EGVRQLRGTSVNPVAGVEHVLVTAGTGVPTSGLILG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)20
MHC class II prediction (Propred)47
MHC class 1 prediction (Propred1)266
CTL epitope prediction (CTLpred)53
Prediction of interferon-gamma inducing peptides (IFNepitope)151
Prediction of IL4 inducing peptides (IL4pred)254