Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID386006366
StrainMtb_RGTB423
Protein IDYP_005924645.1
Description hypothetical protein MRGA423_22385 [Mycobacterium tuberculosis RGTB
Sequence MTGVSDIQEAVAQIKAAGPSKPRLARDPVNQPMINNWVEAIGDRNPIYVD
DAAARAAGHPGIVAPPAMIQVWTMMGLGGVRPKDDPLGPIIKLFDDAGYI
GVVATNCEQTYHRYLLPGEQVSISAELGDVVGPKQTALGEGWFINQHIVW
QVGDEDVAEMNWRILKFKPAGSPSSVPDDLDPDAMMRPSSSRDTAFFWDG
VKAHELRIQRLADGSLRHPPVPAVWQDKSVPINYVVSSGRGTVFSFVVHH
APKVPGRTVPFVIALVELEEGVRMLGELRGADPARVAIGMPVRATYIDFP
DWSLYAWEPDE
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)30
MHC class II prediction (Propred)50
MHC class 1 prediction (Propred1)200
CTL epitope prediction (CTLpred)48
Prediction of interferon-gamma inducing peptides (IFNepitope)121
Prediction of IL4 inducing peptides (IL4pred)205