Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID386006367
StrainMtb_RGTB423
Protein IDYP_005924646.1
Description cytochrome P450 [Mycobacterium tuberculosis RGTB423]
Sequence MPSPNLPPGFDFTDPAIYAERLPVAEFAELRSAAPIWWNGQDPGKGGGFH
DGGFWAITKLNDVKEISRHSDVFSSYENGVIPRFKNDIAREDIEVQRFVM
LNMDAPHHTRLRKIISRGFTPRAVGRLHDELQERAQKIAAEAAAAGSGDF
VEQVSCELPLQAIAGLLGVPQEDRGKLFHWSNEMTGNEDPEYAHIDPKAS
SAELIGYAMKMAEEKAKNPADDIVTQLIQADIDGEKLSDDEFGFFVVMLA
VAGNETTRNSITQGMMAFAEHPDQWELYKKVRPETAADEIVRWATPVTAF
QRTALRDYELSGVQIKKGQRVVMFYRSANFDEEVFQDPFTFNILRNPNPH
VGFGGTGAHYCIGANLARMTINLIFNAVADHMPDLKPISAPERLRSGWLN
GIKHWQVDYTGRCPVAH
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)39
MHC class II prediction (Propred)59
MHC class 1 prediction (Propred1)281
CTL epitope prediction (CTLpred)62
Prediction of interferon-gamma inducing peptides (IFNepitope)183
Prediction of IL4 inducing peptides (IL4pred)317