Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID392384919
StrainMtb_UT205
Protein IDYP_005306548.1
Description unnamed protein product [Mycobacterium tuberculosis UT205]
Sequence MTLAIPSGIDLSHIDADARPQDDLFGHVNGRWLAEHEIPADRATDGAFRS
LFDRAETQVRDLIIQASQAGAAVGTDAQRIGDLYASFLDEEAVERAGVQP
LHDELATIDSAADATELAAALGTLQRAGVGGGIGVYVDTDSKDSTRYLVH
FTQSGIGLPDESYYRDEQHAAVLAAYPGHIARMFGLVYGGESRDHAKTAD
RIVALETKLADAHWDVVKRRDADLGYNLRTFAQLQTEGAGFDWVSWVTAL
GSAPDAMTELVVRQPDYLVTFASLWASVNVEDWKCWARWRLIRARAPWLT
RALVAEDFEFYGRTLTGAQQLRDRWKRGVSLVENLMGDAVGKLYVQRHFP
PDAKSRIDTLVDNLQEAYRISISELDWMTPQTRQRALAKLNKFTAKVGYP
IKWRDYSKLAIDRDDLYGNVQRGYAVNHDRELAKLFGPVDRDEWFMTPQT
VNAYYNPGMNEIVFPAAILQPPFFDPQADEAANYGGIGAVIGHEIGHGFD
DQGAKYDGDGNLVDWWTDDDRTEFAARTKALIEQYHAYTPRDLVDHPGPP
HVQGAFTIGENIGDLGGLSIALLAYQLSLNGNPAPVIDGLTGMQRVFFGW
AQIWRTKSRAAEAIRRLAVDPHSPPEFRCNGVVRNVDAFYQAFDVTEDDA
LFLDPQRRVRIWN
B cell epitope (IEDB)0
T cell epitope (IEDB)2
MHC binder (IEDB)1
Vaccine TargetYes
B cell prediction (LBtope)60
MHC class II prediction (Propred)93
MHC class 1 prediction (Propred1)455
CTL epitope prediction (CTLpred)112
Prediction of interferon-gamma inducing peptides (IFNepitope)297
Prediction of IL4 inducing peptides (IL4pred)418