Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID392386888
StrainMtb_UT205
Protein IDYP_005308517.1
Description kasB [Mycobacterium tuberculosis UT205]
Sequence MGVPPLAGASRTDMEGTFARPMTELVTGKAFPYVVVTGIAMTTALATDAE
TTWKLLLDRQSGIRTLDDPFVEEFDLPVRIGGHLLEEFDHQLTRIELRRM
GYLQRMSTVLSRRLWENAGSPEVDTNRLMVSIGTGLGSAEELVFSYDDMR
ARGMKAVSPLTVQKYMPNGAAAAVGLERHAKAGVMTPVSACASGAEAIAR
AWQQIVLGEADAAICGGVETRIEAVPIAGFAQMRIVMSTNNDDPAGACRP
FDRDRDGFVFGEGGALLLIETEEHAKARGANILARIMGASITSDGFHMVA
PDPNGERAGHAITRAIQLAGLAPGDIDHVNAHATGTQVGDLAEGRAINNA
LGGNRPAVYAPKSALGHSVGAVGAVESILTVLALRDQVIPPTLNLVNLDP
EIDLDVVAGEPRPGNYRYAINNSFGFGGHNVAIAFGRY
B cell epitope (IEDB)1
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)36
MHC class II prediction (Propred)56
MHC class 1 prediction (Propred1)281
CTL epitope prediction (CTLpred)73
Prediction of interferon-gamma inducing peptides (IFNepitope)180
Prediction of IL4 inducing peptides (IL4pred)296