Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID392431734
StrainMtb_KZN_605
Protein IDYP_006472778.1
Description phiRv2 phage integrase [Mycobacterium tuberculosis KZN 605]
Sequence MTQTGKRQRRKFGRIRQFNSGRWQASYTGPDGRVYIAPKTFNAKIDAEAW
LTDRRREIDRQLWSPASGQEDRPGAPFGEYAEGWLKQRGIKDRTRAHYRK
LLDNHILATFADTDLRDITPAAVRRWYATTAVGTPTMRAHSYSLLRAIMQ
TALADDLIDSNPCRISGASTARRVHKIRPATLDELETITKAMPDPYQAFV
LMAAWLAMRYGELTELRRKDIDLHGEVARVRRAVVRVGEGFKVTTPKSDA
GVRDISIPPHLIPAIEDHLHKHVNPGRESLLFPSVNDPNRHLAPSALYRM
FYKARKAAGRPDLRVHDLRHSGAVLAASTGATLAELMQRLGHSTAGAALR
YQHAAKGRDREIAALLSKLAENQEM
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)28
MHC class II prediction (Propred)40
MHC class 1 prediction (Propred1)272
CTL epitope prediction (CTLpred)82
Prediction of interferon-gamma inducing peptides (IFNepitope)168
Prediction of IL4 inducing peptides (IL4pred)276