Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID392432485
StrainMtb_KZN_605
Protein IDYP_006473529.1
Description transcriptional regulator [Mycobacterium tuberculosis KZN 605]
Sequence MARRVVIVGFPGDPVDTVILPGGAGVDAARSEPALIDWVKAVSGTARRVV
TVCTGAFLAAEAGLLGRTPSDDALGLCRTFRPRISGRSGRCRPDLHAQFA
EGVDRGWSHRRHRPRAGTGRRRPRHRDCPDGCPLARPVSAPTRWADPVRG
SGVDATRQTDLDPPGAGGHRGRAGGAHRIGELAQRAAMSPRHFTRVFSDE
VGEAPGRYVERIRTEAARRQLEETHDTVVAIAARCGFGTAETMRRSFIRR
VGISPDQYRKAFA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)14
MHC class II prediction (Propred)25
MHC class 1 prediction (Propred1)168
CTL epitope prediction (CTLpred)41
Prediction of interferon-gamma inducing peptides (IFNepitope)138
Prediction of IL4 inducing peptides (IL4pred)175