Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID392432508
StrainMtb_KZN_605
Protein IDYP_006473552.1
Description catalase-peroxidase-peroxynitritase T katG [Mycobacterium tuberculo
Sequence MPEQHPPITETTTGAASNGCPVVGHMKYPVEGGGNQDWWPNRLNLKVLHQ
NPAVADPMGAAFDYAAEVATIDVDALTRDIEEVMTTSQPWWPADYGHYGP
LFIRMAWHAAGTYRIHDGRGGAGGGMQRFAPLNSWPDNASLDKARRLLWP
VKKKYGKKLSWADLIVFAGNCALESMGFKTFGFGFGRVDQWEPDEVYWGK
EATWLGDERYSGKRDLENPLAAVQMGLIYVNPEGPNGNPDPMAAAVDIRE
TFRRMAMNDVETAALIVGGHTFGKTHGAGPADLVGPEPEAAPLEQMGLGW
KSSYGTGTGKDAITTGIEVVWTNTPTKWDNSFLEILYGYEWELTKSPAGA
WQYTAKDGAGAGTIPDPFGGPGRSPTMLATDLSLRVDPIYERITRRWLEH
PEELADEFAKAWYKLIHRDMGPVARYLGPLVPKQTLLWQDPVPAVSHDLV
GEAEIASLKSQIRASGLTVSQLVSTAWAAASSFRGSDKRGGANGGRIRLQ
PQVGWEVNDPDGDLRKVIRTLEEIQESFNSAAPGNIKVSFADLVVLGGCA
AIEKAAKAAGHNITVPFTPGRTDASQEQTDVESFAVLEPKADGFRNYLGK
GNPLPAEYMLLDKANLLTLSAPEMTVLVGGLRVLGANYKRLPLGVFTEAS
ESLTNDFFVNLLDMGITWEPSPADDGTYQGKDGSGKVKWTGSRVDLVFGS
NSELRALVEVYGADDAQPKFVQDFVAAWDKVMNLDRFDVR
B cell epitope (IEDB)0
T cell epitope (IEDB)4
MHC binder (IEDB)4
Vaccine TargetYes
B cell prediction (LBtope)41
MHC class II prediction (Propred)92
MHC class 1 prediction (Propred1)499
CTL epitope prediction (CTLpred)97
Prediction of interferon-gamma inducing peptides (IFNepitope)323
Prediction of IL4 inducing peptides (IL4pred)583