Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID392434350
StrainMtb_KZN_605
Protein IDYP_006475395.1
Description hypothetical protein TBXG_003883 [Mycobacterium tuberculosis KZN 60
Sequence MASGSGLCKTTSNFIWGQLLVLGEGIPDPGDIFNTGSSLFKQISDKMGLA
IPGTNWIGQAAEAYLNQNIAQQLRAQVMGDLDKLTGNMISNQAKYVSDTR
DVLRAMKKMIDGVYKVCKGLEKIPLLGHLWSWELAIPMSGIAMAVVGGAL
LYLTIMTLMNATNLRGILGRLIEMLTTLPKFPGLPGLPSLPDIIDGLWPP
KLPDIPIPGLPDIPGLPDFKWPPTPGSPLFPDLPSFPGFPGFPEFPAIPG
FPALPGLPSIPNLFPGLPGLGDLLPGVGDLGKLPTWTELAALPDFLGGFA
GLPSLGFGNLLSFASLPTVGQVTATMGQLQQLVAAGGGPSQLASMGSQQA
QLISSQAQQGGQQHATLVSDKKEDEEGVAEAERAPIDAGTAASQRGQEGT
VL
B cell epitope (IEDB)6
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)67
MHC class II prediction (Propred)62
MHC class 1 prediction (Propred1)243
CTL epitope prediction (CTLpred)37
Prediction of interferon-gamma inducing peptides (IFNepitope)165
Prediction of IL4 inducing peptides (IL4pred)256