Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID392434369
StrainMtb_KZN_605
Protein IDYP_006475414.1
Description membrane-anchored mycosin mycP1 [Mycobacterium tuberculosis KZN 605
Sequence MHRIFLITVALALLTASPASAITPPPIDPGALPPDVTGPDQPTEQRVLCA
SPTTLPGSGFHDPPWSNTYLGVADAHKFATGAGVTVAVIDTGVDASPRVP
AEPGGDFVDQAGNGLSDCDAHGTLTASIIAGRPAPTDGFVGVAPDARLLS
LRQTSEAFEPVGSQANPNDPNATPAAGSIRSLARAVVHAANLGVGVINIS
EAACYKVSRPIDETSLGASIDYAVNVKGVVVVVAAGNTGGDCVQNPAPDP
STPGDPRGWNNVQTVVTPAWYAPLVLSVGGIGQTGMPSSFSMHGPWVDVA
APAENIVALGDTGEPVNALQGREGPVPIAGTSFAAAYVSGLAALLRQRFP
DLTPAQIIHRITATARHPGGGVDDLVGAGVIDAVAALTWDIPPGPASAPY
NVRRLPPPVVEPGPDRRPITAVALVAVGLTLALGLGALARRALSRR
B cell epitope (IEDB)2
T cell epitope (IEDB)10
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)60
MHC class II prediction (Propred)98
MHC class 1 prediction (Propred1)553
CTL epitope prediction (CTLpred)128
Prediction of interferon-gamma inducing peptides (IFNepitope)361
Prediction of IL4 inducing peptides (IL4pred)556