Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID395138336
StrainMtb_H37Rv_broad
Protein IDAFN49495.1
Description phiRv1 phage protein [Mycobacterium tuberculosis H37Rv]
Sequence MPRPPKPARLKLVEGRSPGRDSGGRKVPESPKFIRQAPDAPDWLDAEALA
EWRRVAPTLERLDLLKPEDRALLSAYCETWSVYVAAVQRVRAEGLTITSP
KSGVVHRNPAVTVAETARMHLLRLASEFGLTPAAEQRLAVAPGDDGDGLN
PFAPDR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)20
MHC class II prediction (Propred)18
MHC class 1 prediction (Propred1)100
CTL epitope prediction (CTLpred)20
Prediction of interferon-gamma inducing peptides (IFNepitope)63
Prediction of IL4 inducing peptides (IL4pred)114