Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID395140747
StrainMtb_H37Rv_broad
Protein IDAFN51906.1
Description ESX-1 secretion system protein eccD1 [Mycobacterium tuberculosis H37Rv]
Sequence MSAPAVAAGPTAAGATAARPATTRVTILTGRRMTDLVLPAAVPMETYIDD
TVAVLSEVLEDTPADVLGGFDFTAQGVWAFARPGSPPLKLDQSLDDAGVV
DGSLLTLVSVSRTERYRPLVEDVIDAIAVLDESPEFDRTALNRFVGAAIP
LLTAPVIGMAMRAWWETGRSLWWPLAIGILGIAVLVGSFVANRFYQSGHL
AECLLVTTYLLIATAAALAVPLPRGVNSLGAPQVAGAATAVLFLTLMTRG
GPRKRHELASFAVITAIAVIAAAAAFGYGYQDWVPAGGIAFGLFIVTNAA
KLTVAVARIALPPIPVPGETVDNEELLDPVATPEATSEETPTWQAIIASV
PASAVRLTERSKLAKQLLIGYVTSGTLILAAGAIAVVVRGHFFVHSLVVA
GLITTVCGFRSRLYAERWCAWALLAATVAIPTGLTAKLIIWYPHYAWLLL
SVYLTVALVALVVVGSMAHVRRVSPVVKRTLELIDGAMIAAIIPMLLWIT
GVYDTVRNIRF
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)68
MHC class II prediction (Propred)194
MHC class 1 prediction (Propred1)765
CTL epitope prediction (CTLpred)204
Prediction of interferon-gamma inducing peptides (IFNepitope)352
Prediction of IL4 inducing peptides (IL4pred)603