Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID399989187
StrainM_smegmatis_str_MC2_155_second
Protein IDYP_006569537.1
Description methylmalonyl CoA epimerase [Mycobacterium smegmatis str. MC2 155]
Sequence MTTEHVDARPALASALVTAIDHVGIAVPDLDAAAKWYHDHLGMIVLHEEI
NEEQGVREAMLSVRGAPKGSAQIQLLAPIDEKSTIAKFIDTRGPGLQQLA
YRTSDIDALSDRLRADGVRLLYDAPKRGTANSRINFIHPKDAGGVLIELV
EPSPEEH
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo