Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID399989476
StrainM_smegmatis_str_MC2_155_second
Protein IDYP_006569826.1
Description 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Mycobacterium s
Sequence MPPTINMGIPGASSSVSGGGRSQVSGKRVLLAEPRGYCAGVDRAVETVER
ALEKHGAPVYVRHEIVHNRHVVETLAKAGAIFVDETDEVPEGAIVVFSAH
GVAPTVHQSAAERNLKVIDATCPLVTKVHNEAKRFARDDYDILLIGHEGH
EEVVGTAGEAPDHVQLVDGPESVDAVTVRDESKVIWLSQTTLSVDETMET
VRRLREKFPTLQDPPSDDICYATQNRQVAVKAMAPECELVIVVGSRNSSN
SVRLVEVALNAGSDAAHLVDYADDIDPAWLDGVTTIGVTSGASVPEILVR
GVLERLAEHGYDTVQPVTTANETLVFALPREIRPPRG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)1
Vaccine TargetNo