Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID399989522
StrainM_smegmatis_str_MC2_155_second
Protein IDYP_006569872.1
Description lipolytic enzyme- G-D-S-L [Mycobacterium smegmatis str. MC2 155]
Sequence MGTRAPRRSTVALAAAATLASTGSAVIGARNLLNGQAAQARRTIPKAWAI
PPRADGVYSPGGGPVERWERGVPFDLHLMIFGDSTATGYGCHSADEVPGV
LLARGVAEQFGQRIRLSTKAIVGATSKGLSGQIDAMFVAGPPPDAAVIMI
GANDITKPNGIGPSARRLGAGVSRLRSAGAAVVVGTCPDFGVITAIPQPL
RWYARSRGLRLARAQAHAVRAAGGVPVPFSDLLTPEFHKTPELLFSEDMF
HPSAAGYALAASQLLPALCNALGQWDGDDALETGAADTSSLWSRLGAMSR
LWRRSTGVPAPVVAAAS
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo