Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID399989618
StrainM_smegmatis_str_MC2_155_second
Protein IDYP_006569968.1
Description transcription regulator GntR family [Mycobacterium smegmatis str. M
Sequence MTGQFGRVDRRPLYEQVADRLREFIDTSGMQPGDKLANVRDLAAELQVGR
SSIREAVNALRAQRIVEVRHGDGIYLLQRPEDVIESLATELVETHVDHPY
IWETRQALETQCARLAAVHATDDDLRELDASLDQMRAEVEKGLPGLEGDR
RFHLGVAVAAHNPLLLRLLKGLRVALDRTSETSLTRPGQPARSLEEHRGV
VEAIRAGDAADAANKMLAHLVGTTDELVRR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo