Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID399989694
StrainM_smegmatis_str_MC2_155_second
Protein IDYP_006570044.1
Description shikimate/quinate 5-dehydrogenase [Mycobacterium smegmatis str. MC2
Sequence MSGADNRRPPINKDTKVCISLAARPSNHGTRFHNYLYDKLGLDFLYKAFS
TTDIAAAIGGVRALGIRGCSVSMPFKQDVMALVDEIEPSARAIDAVNTIV
NDLSVPGGYLVASNTDYIAVQALIEQHGLAEDDPVLIRGSGGMANAVAAA
FRDNGFRRGTIVARNRDTGAALASRLGYEYTPEVAERTAAILVNVTPIGM
AGGPEAQLSAFEPGTVEAAAVVFDVVAMPAETPLIVAARSAGKPVITGAE
VIALQAAEQFERYTGVRPTAEQIAEASAFSRA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo