Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID399989832
StrainM_smegmatis_str_MC2_155_second
Protein IDYP_006570182.1
Description TetR family transcriptional regulator [Mycobacterium smegmatis str.
Sequence MGRHREFDVDKALDAALCVFWRKGYEGASYSDLTQATGVERPALYSAFGN
KEALFLRALDRYYERYMDFIPVALEQPTSREVAEHLLRSAADLNTRYPDH
TGCLGVQGCLVGTDDSEPIRRALVDARASGEASLRARFEDAHATGDLPKS
ANPAALAAFLMTVLHGMAVQAKAGFSRETLDAIIDQALSSWPTPDRGSAG
KATRKR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo