Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID399989851
StrainM_smegmatis_str_MC2_155_second
Protein IDYP_006570201.1
Description glyoxalase/bleomycin resistance protein/dioxygenase [Mycobacterium
Sequence MPIRSTAPLGAPSWIDLTTSDVERAKAFYGAVFGWTFETGGPEYGGYVTA
HLEGHVVAGLMQNDPQWNTPDVWTTYLHTADAQATVAAAAAAGGSNCGGV
MDVPEKGRMAMMSDAAGGFFGLWQPAGHDGFQVFNEPGAPLYHQLTTGDY
AKALQFYRDVFGWTVNTVADTDEFRYSTASFDGDELVGVMDGAAFLGDAP
STWTCFFGADDVDKTIELIVEHGGSVVRPAEDTPYGRLAAVADPTGAGFN
LSSLQD
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo