Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID399990178
StrainM_smegmatis_str_MC2_155_second
Protein IDYP_006570528.1
Description cellulose biosynthetic (CelD)-like protein [Mycobacterium smegmatis
Sequence MNGRKLLGSTTSRIVGMDELSDEEIDAWHALRASNQALDSPYFHPGFAAA
VHATGRPVSVVVVRDAAGAVSALLPGHREGAVLHPVGWPAADFQGPICGP
GEAPSPLELLVDGLRVLTFDHLVPQKAGFEPWIVSRRSSPWMDITGGLDG
YLDRVSRSGRDKMKEARRCRVRAERTHGPLRFGVDVVDDDALARLIELKR
AQYVKTGSRDYFAKSAHVQLMHRLLHTRGPGFGGVLSTVHIGDRLVAAHF
GIRSGHVLHWWFPVYDPAFAQLSPGWILLREVIDAAAEIGITRMDLGRGD
DDYKRRAKTGETVVSQAFVSNSVTRRVMRSGRQAMTDAVKRSPLAPSLRR
ALHHVRGVKSSGFPRSVWT
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo