Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID399990182
StrainM_smegmatis_str_MC2_155_second
Protein IDYP_006570532.1
Description colanic acid biosynthesis glycosyl transferase wcaI [Mycobacterium
Sequence MRVAILGINYAPEPTGIAPYTTGLAKGLIDRGHDVRVLTGFPHYPQWRRD
KTRSGFRWNEQIDGVPVFRLSHPVPQRLSWRGRAAMEITFGLQLMTSRWG
RPEVVVCVTPPLLAATMAAVRARVSWPRPAIGMVVQDLYSRGVTETGAAS
GLSASAISHIESSALRLADGVAVIHPGFASQLSGHLGVQAHRIRVIRNWT
HVPSPDPMSSEAFRASHGWGSDELIILHAGNMGFKQGLENVIAAAELAGR
ADQRVRFVLLGDGNQRVHLQSMASGIRAIDFLSPVSDEDFPAALGAADVL
LVNERPGVAQMAVPSKLTSYFRAGKPILAATDEHGFAAREIRAARAGVLV
DPNRPDLLVQEALRLGQDRSRAAQLGEAGGRYCDEVLSAAAAIDSYEDWI
VGLAESIRRAGGGKSGKSDAGANARSQNA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo