Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID399990187
StrainM_smegmatis_str_MC2_155_second
Protein IDYP_006570537.1
Description Polysaccharide biosynthesis protein [Mycobacterium smegmatis str. M
Sequence MMSSPGGRSDKSEALDPEDLPGAEAPVEPLGRSAAAGTLWLTAAQWLMRL
TGLATIAILTRLLTPEDFGVVAAAMTVTPFLLLLADLGLSTYVLQVKRAD
QRLLSTAFWYSLTMAIVLMAAVAAFAPVIASLFDLPKAAPVLRGCSLAAG
FIILCSVPAALLRREMRFRALSLQWLASAVIAQVVAVVLAFRGAGAWALV
SQLVIAEAISCVLVWQAARWRPTLQFSKSEFFDMAKFGNKVIAADVIVAM
RPAAEAAIISTVLGPAALGFLSIAQRLVQVTQDLGGKALVPVSTVVFAKV
RESPERLQSAYLKALGIAYAAVSPLMTVVVVGGTLVVPLLFGQGWDHSVP
VAQALSLAAILTLGAIIDQRLHYGIGRPGRWLVYAGCIGAVEIAVTALVA
HNGLNWVAIGFVSVAFVATVIRWVLVGRLLDIPPRTLARVFAAASVAVAG
SAGAGLLVLSLTGGWAPAWSLAAVMVAVGVVHIGIVRVVSPDVYRTVRSL
VHRAPELDESL
gene ID399990187
StrainM_smegmatis_str_MC2_155_second
Protein IDYP_006570537.1
Description Polysaccharide biosynthesis protein [Mycobacterium smegmatis str. M
Sequence MMSSPGGRSDKSEALDPEDLPGAEAPVEPLGRSAAAGTLWLTAAQWLMRL
TGLATIAILTRLLTPEDFGVVAAAMTVTPFLLLLADLGLSTYVLQVKRAD
QRLLSTAFWYSLTMAIVLMAAVAAFAPVIASLFDLPKAAPVLRGCSLAAG
FIILCSVPAALLRREMRFRALSLQWLASAVIAQVVAVVLAFRGAGAWALV
SQLVIAEAISCVLVWQAARWRPTLQFSKSEFFDMAKFGNKVIAADVIVAM
RPAAEAAIISTVLGPAALGFLSIAQRLVQVTQDLGGKALVPVSTVVFAKV
RESPERLQSAYLKALGIAYAAVSPLMTVVVVGGTLVVPLLFGQGWDHSVP
VAQALSLAAILTLGAIIDQRLHYGIGRPGRWLVYAGCIGAVEIAVTALVA
HNGLNWVAIGFVSVAFVATVIRWVLVGRLLDIPPRTLARVFAAASVAVAG
SAGAGLLVLSLTGGWAPAWSLAAVMVAVGVVHIGIVRVVSPDVYRTVRSL
VHRAPELDESL
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo