Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID399990355
StrainM_smegmatis_str_MC2_155_second
Protein IDYP_006570705.1
Description integral membrane protein TerC [Mycobacterium smegmatis str. MC2 15
Sequence MHVTQLEWIITLSVTIAVLLFDVVIIGRRPHEPTRRETATYLSIYIGLAI
AFGVWTWLFHGHRYGVEFFAGWLTEYSLSVDNLFIFLIIMASFKVPRIYQ
QQALLVGIILALIFRGIFIALGAVAINQFSWVFYIFGAFLVYTAVNLVRD
TDHDDDGDNAVVRFARKHLRTTDKWDGLRLWVRENGKRLITPMFLVIVAL
GTTDLLFALDSIPAIYGLTQEPYLVFTANVFALMGLRQLYFLLGDLLKRL
VYLSQGLAFILAFIGVKLILHALHENELPFINGGEPVHVPEIPTLASLGV
IVVTLLITTAASLYKTRVRDAQ
gene ID399990355
StrainM_smegmatis_str_MC2_155_second
Protein IDYP_006570705.1
Description integral membrane protein TerC [Mycobacterium smegmatis str. MC2 15
Sequence MHVTQLEWIITLSVTIAVLLFDVVIIGRRPHEPTRRETATYLSIYIGLAI
AFGVWTWLFHGHRYGVEFFAGWLTEYSLSVDNLFIFLIIMASFKVPRIYQ
QQALLVGIILALIFRGIFIALGAVAINQFSWVFYIFGAFLVYTAVNLVRD
TDHDDDGDNAVVRFARKHLRTTDKWDGLRLWVRENGKRLITPMFLVIVAL
GTTDLLFALDSIPAIYGLTQEPYLVFTANVFALMGLRQLYFLLGDLLKRL
VYLSQGLAFILAFIGVKLILHALHENELPFINGGEPVHVPEIPTLASLGV
IVVTLLITTAASLYKTRVRDAQ
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo