Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID399990425
StrainM_smegmatis_str_MC2_155_second
Protein IDYP_006570776.1
Description hypothetical protein MSMEI_6050 [Mycobacterium smegmatis str. MC2 1
Sequence MGRTLVMPRGDGIYDEEHRDHDTGSAAEGGAGKPKRVPEDTPDVEMPDET
TQEPPD
gene ID399990425
StrainM_smegmatis_str_MC2_155_second
Protein IDYP_006570776.1
Description hypothetical protein MSMEI_6050 [Mycobacterium smegmatis str. MC2 1
Sequence MGRTLVMPRGDGIYDEEHRDHDTGSAAEGGAGKPKRVPEDTPDVEMPDET
TQEPPD
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo