Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID399990497
StrainM_smegmatis_str_MC2_155_second
Protein IDYP_006570848.1
Description hypothetical protein MSMEI_6123 [Mycobacterium smegmatis str. MC2 1
Sequence MGRTVAVTWHVASTLIAAGLFFFFVIPRWPELMGETSPTLGTVLRIVTGV
LVALTALPVVFTLLRTRRPELGTPELALRLRTTSIVFHVLAGVLIVGTAI
AEIWVSLDSAGSWLFGIYGAAAALALLGAFGFYLAFIAELPPPPPKPVKP
KVNAVRRNTRAAKDTADADEIDKDAADEDEAGEGEDATERAEDSADEPSD
DTAVEASDEDADQTDDETEDATSENNDEPRAAEPESKAVEPESTAVEAES
LDGADTDDSSGGKLRNRRPSNKANKGGSSRFRRRSRGGITVEE
gene ID399990497
StrainM_smegmatis_str_MC2_155_second
Protein IDYP_006570848.1
Description hypothetical protein MSMEI_6123 [Mycobacterium smegmatis str. MC2 1
Sequence MGRTVAVTWHVASTLIAAGLFFFFVIPRWPELMGETSPTLGTVLRIVTGV
LVALTALPVVFTLLRTRRPELGTPELALRLRTTSIVFHVLAGVLIVGTAI
AEIWVSLDSAGSWLFGIYGAAAALALLGAFGFYLAFIAELPPPPPKPVKP
KVNAVRRNTRAAKDTADADEIDKDAADEDEAGEGEDATERAEDSADEPSD
DTAVEASDEDADQTDDETEDATSENNDEPRAAEPESKAVEPESTAVEAES
LDGADTDDSSGGKLRNRRPSNKANKGGSSRFRRRSRGGITVEE
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo