Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID399990528
StrainM_smegmatis_str_MC2_155_second
Protein IDYP_006570879.1
Description propanediol dehydratase- small subunit [Mycobacterium smegmatis str
Sequence MNDKFTDKYTVAAAVDGKLDLSDLRMDPAVLAHQAVIAEENGNPQLAENF
LRAAELATIDDEDVMRLYEALRPYRSSAEDLDALQASLESRGAARCAELV
RQAAEAYARRGLLR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo