Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID399991045
StrainM_smegmatis_str_MC2_155_second
Protein IDYP_006571396.1
Description Epoxide hydrolase [Mycobacterium smegmatis str. MC2 155]
Sequence MTEPFEVRITEAEIADLRDRLRRTRWPEPEPVDDWSQGIPLAYVQELCHS
WAHDYDFGFAERLNAFPQFRDTIDGLGIHFLHVRSPEPTAFPLVLTHGWP
GSVLEFLEVLGPLTDPRAHGGDPADAFHVVAPSLPGYGWSDKPSTTGWGI
TRIARAWDTLMVSLGYQRYGAQGGDWGSAVSGALGEVAPERVAGVHLNMG
SVAAGTFDDPTPAELANLAAANEFQRTGRGYSAQQATRPQTLGYGLTDSP
AGQAAWIAEKFWAWTDNNGHPEDAVSRQQILDEISVYWFTASATSSARLY
WESFANFRDKVTAPSGLSIYPRDISRPSRREAELRFTDLRWFEELPRGGH
FAAMEQPESLVEQVRGFFRLIR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo