Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID406028905
StrainM_indicus_prani_MTCC_9506
Protein IDYP_006727796.1
Description hypothetical protein MIP_01029 [Mycobacterium indicus pranii MTCC 9
Sequence MREQLAVPARAVGGFFEMMMDTGRAAFRRPFQFGEFLDQTWMIARVSLVP
TLLVSIPFTVLVAFTLNILLREIGAADLSGAGTAFGTITQLGPVVTVLVV
AGAGATAICADLGARTIREEIDAMRVLGIDPIQRLVVPRVLASTVVALLL
NGLVCAIGLSGGYVFSVFLQGVNPGAFINGLTVLTGLRELVLAEVKALLF
GVMAGMVGCYRGLTVKGGPKGVGNAVNETVVYAFICLFVINVVMTAIGVR
ISAK
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)11
MHC class II prediction (Propred)73
MHC class 1 prediction (Propred1)187
CTL epitope prediction (CTLpred)53
Prediction of interferon-gamma inducing peptides (IFNepitope)115
Prediction of IL4 inducing peptides (IL4pred)165