Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID41407014
StrainM_avium_K-10
Protein IDNP_959850.1
Description hypothetical protein MAP0916 [Mycobacterium avium subsp. paratuberculos
Sequence MRILVVDDDRAVRESLRRSLSFNGYSVELAHDGVEALDMIASDRPDALVL
DVMMPRLDGLEVCRQLRSTGDDLPILVLTARDSVSERVAGLDAGADDYLP
KPFALEELLARMRALLRRTKPEDDAESVAMTFSDLTLDPVTREVTRGQRR
ISLTRTEFALLEMLIANPRRVLTRSRILEEVWGFDFPTSGNALEVYVGYL
RRKTEADGEPRLIHTVRGVGYVLRETPP
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)15
MHC class II prediction (Propred)40
MHC class 1 prediction (Propred1)158
CTL epitope prediction (CTLpred)47
Prediction of interferon-gamma inducing peptides (IFNepitope)87
Prediction of IL4 inducing peptides (IL4pred)149