Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID41407931
StrainM_avium_K-10
Protein IDNP_960767.1
Description hypothetical protein MAP1833c [Mycobacterium avium subsp. paratuberculo
Sequence MQRRIMGIETEFGVTCTFHGHRRLSPDEVARYLFRRVVSWGRSSNVFLRN
GARLYLDVGSHPEYATAECDNLVQLVTHDRAGEWVLEDLLVDAEQRLADE
GIGGDIYLFKNNTDSAGNSYGCHENYLIVRAGEFSRISDVLLPFLVTRQL
ICGAGKVLQTPKAATFCLSQRAEHIWEGVSSATTRSRPIINTRDEPHADA
EKYRRLHVIVGDSNMCETTTMLKVGTAALVLEMIEAGVPFRDFSLDNPIR
AIREVSHDITGRRPVRLAGGRQASALDIQREYYSRAVEHLQTREPNAQIE
QIVDLWGRQLDAVESQDFAKVDTEIDWVIKRKLFQRYQDRYNMELSDPKI
AQLDLAYHDIKRGRGVFDLLQRKGLAARVTTDEDIAEAVDTPPQTTRARL
RGEFISAAQAAGRDFTVDWVHLKLNDQAQRTVLCKDPFRAVDERVKRLIA
SM
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)26
MHC class II prediction (Propred)61
MHC class 1 prediction (Propred1)324
CTL epitope prediction (CTLpred)77
Prediction of interferon-gamma inducing peptides (IFNepitope)182
Prediction of IL4 inducing peptides (IL4pred)302