Antigen Card |
The is the antigen card for every antigen and all its information available in our database.
| gene ID | 433625449 |
| Strain | M_canettii_CIPT_140060008 |
| Protein ID | YP_007259078.1 |
| Description | Heat shock protein transcriptional repressor HspR [Mycobacterium ca |
| Sequence | MAKNPKDGESRTFLISVAAELAGMHAQTLRTYDRLGLVSPRRTSGGGRRY SLHDVELLRQVQHLSQDEGVNLAGIKRIIELTSQVEALQSRLQEMAEELA VLRANQRREVAVVPKSTALVVWKPRR |
| B cell epitope (IEDB) | 0 |
| T cell epitope (IEDB) | 0 |
| MHC binder (IEDB) | 0 |
| Vaccine Target | Yes |
| B cell prediction (LBtope) | 7 |
| MHC class II prediction (Propred) | 19 |
| MHC class 1 prediction (Propred1) | 87 |
| CTL epitope prediction (CTLpred) | 27 |
| Prediction of interferon-gamma inducing peptides (IFNepitope) | 38 |
| Prediction of IL4 inducing peptides (IL4pred) | 61 |