Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433625523
StrainM_canettii_CIPT_140060008
Protein IDYP_007259152.1
Description Superoxide dismutase [Cu-Zn] SodC [Mycobacterium canettii CIPT 1400
Sequence MPKPADHRNHAAVSTSVLSALFLGAGAALLSACSSPQHASTVPGTTPSIW
TGSPAPSGLSGHDEESPGAQSLTSTLTAPDGTKVATAKFEFANGYATITI
ATTGVGQLTPGFHGLHIHQVGKCEPNSVAPTGGAPGNFLSAGGHYHVPGH
TGTPASGDLASLQVRGDGSAMLVTTTDAFTMDDLLSGAKTAIIIHAGADN
FANIPPERYVQVNGTPGPDETTLTTGDAGKRVACGVIGSG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)13
MHC class II prediction (Propred)20
MHC class 1 prediction (Propred1)134
CTL epitope prediction (CTLpred)17
Prediction of interferon-gamma inducing peptides (IFNepitope)73
Prediction of IL4 inducing peptides (IL4pred)137