Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433625541
StrainM_canettii_CIPT_140060008
Protein IDYP_007259170.1
Description Conserved membrane protein of unknown function- MmpL4 [Mycobacteriu
Sequence MSTKFANDSNTNARPEKPFIARMIHAFAVPIILGWLAVCVVVTVFVPSLE
AVGQERSVSLSPKDAPSFEAMGRIGMVFKEGDSDSFAMVIIEGNQPLGDA
AHKYYDGLVAQLRADKKHVQSVQDLWGDPLTAAGVQSNDGKAAYVQLSLA
GNQGTPLANESVEAVRSIVESTPAPPGIKAYVTGPSALAADMHHSGDRSM
ARITMVTVAVIFIMLLLVYRSIITVVLLLITVGVELTAARGVVAVLGHSG
AIGLTTFAVSLLTSLAIAAGTDYGIFIIGRYQEARQAGEDKEAAYYTMYR
GTAHVILGSGLTIAGATFCLSFARMPYFQTLGIPCAVGMLVAVAVALTLG
PAVLHVGSRFGLFDPKRLLKVRGWRRVGTVVVRWPLPVLVATCAIALVGL
LALPGYKTSYNDRDYLPDFIPANQGYAAADRHFSQARMKPEILMIESDHD
MRNPADFLVLDKLAKGIFRVPGISRVQAITRPEGTTMDHTSIPFQISMQN
AGQLQTIKYQRDRANDMLKQADEMATTIAVLTRMHSLMAEMASTTHRMVG
DTEEMKEITEELRDHVADFDDFWRPIRSYFYWEKHCYGIPICWSFRSIFD
ALDGIDKLSEQIGVLLGDLREMDRLMPQMVAQIPPQIEAMENMRTMILTM
HSTMTGIFDQMLEMSDNATAMGKAFDAAKNDDSFYLPPEVFKNKDFQRAM
KSFLSSDGHAARFIILHRGDPQSPEGIKSIDAIRTAAEESLKGTPLEDAK
IYLAGTAAVFHDISEGAQWDLLIAAISSLCLIFIIMLIITRAFIAAAVIV
GTVALSLGASFGLSVLLWQHILAIHLHWLVLAMSVIVLLAVGSDYNLLLV
SRFKQEIGAGLKTGIIRSMGGTGKVVTNAGLVFAVTMASMAVSDLRVIGQ
VGTTIGLGLLFDTLIVRSFMTPSIAALLGRWFWWPLRVRSRPGRTPTVPS
ETQPAGRPLAMSSDRLG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)75
MHC class II prediction (Propred)212
MHC class 1 prediction (Propred1)693
CTL epitope prediction (CTLpred)177
Prediction of interferon-gamma inducing peptides (IFNepitope)377
Prediction of IL4 inducing peptides (IL4pred)638