Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433625559
StrainM_canettii_CIPT_140060008
Protein IDYP_007259188.1
Description Isocitrate lyase Icl (isocitrase) (isocitratase) [Mycobacterium can
Sequence MSVVGTPKSAEQIQQEWDTNPRWKDVTRTYSAEDVVALQGSVVEEHTLAR
RGAEVLWEQLHDLEWVNALGALTGNMAVQQVRAGLKAIYLSGWQVAGDAN
LSGHTYPDQSLYPANSVPQVVRRINNALQRADQIAKIEGDTSVENWLAPI
VADGEAGFGGALNVYELQKALIAAGVAGSHWEDQLASEKKCGHLGGKVLI
PTQQHIRTLTSARLAADVADVPTVVIARTDAEAATLITSDVDERDQPFIT
GERTREGFYRTKNGIEPCIARAKAYAPFADLIWMETGTPDLEAARQFSEA
VKAEYPDQMLAYNCSPSFNWKKHLDDATIAKFQKELAAMGFKFQFITLAG
FHALNYSMFDLAYGYAQNQMSAYVELQEREFAAEERGYTATKHQREVGAG
YFDRIATTVDPNSSTTALTGSTEEGQFH
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)28
MHC class II prediction (Propred)48
MHC class 1 prediction (Propred1)284
CTL epitope prediction (CTLpred)47
Prediction of interferon-gamma inducing peptides (IFNepitope)116
Prediction of IL4 inducing peptides (IL4pred)271