Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433625562
StrainM_canettii_CIPT_140060008
Protein IDYP_007259191.1
Description Mycolic acid synthase PcaA (cyclopropane synthase) [Mycobacterium c
Sequence MSVQLTPHFGNVQAHYDLSDDFFRLFLDPTQTYSCAYFERDDMTLQEAQI
AKIDLALGKLNLEPGMTLLDIGCGWGATMRRAIEKYDVNVVGLTLSENQA
GHVQKMFDQMDTPRSRRVLLEGWEKFDEPVDRIVSIGAFEHFGHQRYHHF
FEVTHRTLPADGKMLLHTIVRPTFKEGREKGLTLTHELVHFTKFILAEIF
PGGWLPSIPTVHEYAEKVGFRVTAVQSLQLHYARTLDMWATALEANKDQA
IAIQSQTVYDRYMKYLTGCAKLFRQGYTDVDQFTLEK
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)32
MHC class II prediction (Propred)41
MHC class 1 prediction (Propred1)203
CTL epitope prediction (CTLpred)35
Prediction of interferon-gamma inducing peptides (IFNepitope)129
Prediction of IL4 inducing peptides (IL4pred)244