Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433625904
StrainM_canettii_CIPT_140060008
Protein IDYP_007259533.1
Description Putative phosphate-transport ATP-binding protein ABC transporter Ph
Sequence MAKRLDLTDVNIYYGSFHAVADVSLAILPRSVTAFIGPSGCGKTTVLRTL
NRMHEVIPGARVEGAVLLDDQDIYAPGIDPVGVRRAIGMVFQRPNPFPAM
SIRNNVVAGLKLQGVRNRKVLDDTAESSLRGANLWDEVKDRLDKPGGGLS
GGQQQRLCIARAIAVQPDVLLMDEPCSSLDPISTMAIEDLISELKQRYTI
VIVTHNMQQAARVSDQTAFFNLEAVGKPGRLVEIASTEKIFSNPNQKATE
DYISGRFG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)13
MHC class II prediction (Propred)42
MHC class 1 prediction (Propred1)169
CTL epitope prediction (CTLpred)52
Prediction of interferon-gamma inducing peptides (IFNepitope)114
Prediction of IL4 inducing peptides (IL4pred)174