Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433626014
StrainM_canettii_CIPT_140060008
Protein IDYP_007259643.1
Description Putative phosphate-transport integral membrane ABC transporter PstA
Sequence MSPSTSIEALDQPVKPVVFRPLTLRRRIKNSVATTFFFTSFVVALIPLVW
LLWVVIARGWFAVTRSGWWTHSLRGVLPEQFAGGVYHALYGTLVQAGVAA
VLAVPLGLMTAVYLVEYGTGRMARVTTFTVDVLAGVPSIVAALFVFSLWI
ATLGFQQSAFAVALALVLLMLPVVVRAGEEMLRLVPDELREASYALGVPK
WKTIVRIVAPIAMPGIVSGILLSIARVVGETAPVLVLVGYSHSINLDVFH
GNMASLPLLIYTELTNPEHAGFLRVWGAALTLIIVVATINLAAAMIRFVA
TRRR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)7
Vaccine TargetYes
B cell prediction (LBtope)10
MHC class II prediction (Propred)81
MHC class 1 prediction (Propred1)235
CTL epitope prediction (CTLpred)87
Prediction of interferon-gamma inducing peptides (IFNepitope)127
Prediction of IL4 inducing peptides (IL4pred)188