Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433626058
StrainM_canettii_CIPT_140060008
Protein IDYP_007259687.1
Description Putative metal cation transporter P-type ATPase CtpV [Mycobacterium
Sequence MRVCVTGFNVDAVRAVAIEETVSQVTGVHAVHAYPRTASVVIWYSPELGD
TAAVLSAIAEARHVPEELVPARAPHSAGVRGVGVVRKITGGIRRMLSRPP
GVDKPLKASRCGGRPRGPVRGSASWPGEQNRRERRTWLPRVWLALPLGLL
ALGSSMFFGAYPWAGWLAFAATLPVQFVAGWPILRGAVQQARALTSNMDT
LIALGTLTAFVYSTYQLFAGGPLFFDTSALIITFVVLGRHLEARATGKAS
EAISKLLELGAKEATLLVDGQELLVPVDQVQVGDLVRVRPGEKIPVDGEV
TDGRAAVDESMLTGESVPVEKTAGDRVAGATVNLDGLLTVRATAVGADTA
LAQIVRLVEQAQGDKAPVQRLADRVSAVFVPAVIGVAVATFAGWTLIAAN
PVAGMTAAVAVLIIACPCALGLATPTAIMVGTGRGAELGILVKGGEVLEA
SKKIDTVVFDKTGTLTRARMRVTDVIAGQRRQPNQVLRLAAAVESGSEHP
IGAAIVAAAHERGLAIPAANAFTAVAGHGVRAQVNGGPVVVGRRKLVDEQ
HLVLPDHLAAAAVEQEERGRTAVFVGQDGQVVGVLAVADTVKDDAADVVG
RLHAMGLQVAMITGDNARTAAAIAKQVGIEKVLAEVLPQDKVAEVRRLQD
QGRVVAMVGDGVNDAPALVQADLGIAIGTGTDVAIEASDITLMSGRLDGV
VRAIELSRQTLRTIYQNLGWAFGYNTAAIPLAALGALNPVVAGAAMGFSS
VSVVTNSLRLRRFGRDGRTA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)52
MHC class II prediction (Propred)127
MHC class 1 prediction (Propred1)542
CTL epitope prediction (CTLpred)136
Prediction of interferon-gamma inducing peptides (IFNepitope)372
Prediction of IL4 inducing peptides (IL4pred)465