Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433626189
StrainM_canettii_CIPT_140060008
Protein IDYP_007259818.1
Description Putative glycosyl hydrolase [Mycobacterium canettii CIPT 140060008]
Sequence MPKRRDNQTWRYWRTVTGVVVAGAVLVVGGLSGRVTRAENLSCSVIKCVA
LTFDDGPGPYTDRLLHILTDNDAKATFFLIGNKVAANPAGARRIADAGME
IGSHTWEHPNMTTIPPEDIPGQFSRANDVIAAATGRTPTLYRPAGGLSND
AVRQAAAKVGQAEILWDVIPFDWINDSNTAATRHMLMTQIKPGSVVLFHD
TYSSTVDVVYQFIPVLKANGYRLVTVSELLGPRAPGSSYGSRENGPPVNE
LRDIPASEIPPLPNTSSPKPMPNFPITDIAGQNSGGPNNGA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)2
Vaccine TargetYes
B cell prediction (LBtope)30
MHC class II prediction (Propred)40
MHC class 1 prediction (Propred1)186
CTL epitope prediction (CTLpred)44
Prediction of interferon-gamma inducing peptides (IFNepitope)99
Prediction of IL4 inducing peptides (IL4pred)198