Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433626839
StrainM_canettii_CIPT_140060008
Protein IDYP_007260468.1
Description Putative transmembrane serine/threonine-protein kinase E PknE (prot
Sequence MDGTAESREGTQFGPYRLRRLVGRGGMGDVYEAEDTVRERIVALKLMSET
LSSDPVFRTRMQREARTAGRLQEPHVVPIHDFGEIDGQLYVDMRLINGVD
LAAMLRRQGPLAPPRAVAIVRQIGSALDAAHAAGVTHRDVKPENILVSAD
DFAYLVDFGIASATTDEKLTQLGNTVGTLYYMAPERFSESHATYRADIYA
LTCVLYECLTGSPPYQGDQLSVMGAHINQAIPRPSTVRPGIPVAFDAVIA
RGMAKNPEDRYVTCGDLSAAAHAALATADQDRATDILRRSQVAKLPVPST
HPVSPGTRWPQPTPWAGGAPPWGPPSSPLPRSARQPWLWVGVAVAVVVAL
AGGLGIALAHPWRSSGPRTSAPPPPPPADAVELRVLNDGVFVGSSVAPTT
IDIFNEPICPPCGSFIRSYASDIDTAVADKQLAVRYHLLNFLDDQSHSKN
YSTRAVAASYCVAGQNDPKLYASFYSALFGSDFQPQENAASDRTDAELAH
LAQTVGAEPTAISCIKSGADLGTAQTKATNASETLAGFNASGTPFVWDGS
MVVNYQDPSWLARLIG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)50
MHC class II prediction (Propred)77
MHC class 1 prediction (Propred1)370
CTL epitope prediction (CTLpred)81
Prediction of interferon-gamma inducing peptides (IFNepitope)187
Prediction of IL4 inducing peptides (IL4pred)338