Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433626927
StrainM_canettii_CIPT_140060008
Protein IDYP_007260556.1
Description Putative hydrolase [Mycobacterium canettii CIPT 140060008]
Sequence MTSPSVREWRDGGRWLPTAVGKVFVRSGPGDTPTMLLLHGYPSSSFDFRA
VIPHLTGQAWVTMDFLGFGLSDKPRPHRYSLLEQADLVETVVAHTVTGAV
VVLAHDMGTSVTTELLARDLDGRLPFDLRRAVLSNGSVILERASLRPIQK
VLRSPLGPVAARLVSRGGFTRGFGRIFSPAHPLSAQEAQAQWELLCYNDG
NRIPHLLISYLDERIRHAQRWHGAVRDWPKPLGFVWGLDDPVATTNVLNG
LRELRPSAAVVELPGLGHYPQVEAPKAYAEAALSLLVD
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)36
MHC class II prediction (Propred)43
MHC class 1 prediction (Propred1)199
CTL epitope prediction (CTLpred)47
Prediction of interferon-gamma inducing peptides (IFNepitope)136
Prediction of IL4 inducing peptides (IL4pred)203