Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433626965
StrainM_canettii_CIPT_140060008
Protein IDYP_007260594.1
Description L-lactate dehydrogenase (cytochrome) LldD2 [Mycobacterium canettii
Sequence MAVNRRVPRVRDLAPLLQFNRPQFDTSKRRLGAALTIQDLRRIAKRRTPR
AAFDYADGAAEDELSIERARQGFRDIEFHPTILRDVTTVCAGWNVLGQPT
VLPFGIAPTGFTRLMHTEGEIAGARAAAAAGIPFSLSTLATCAIEDLVIA
VPQGRKWFQLYMWRDRDRSMALVRRAAAAGFDTMLVTVDVPVAGARLRDV
RNGMSIPPALTLRTVLDAMGHPRWWFDLLTTEPLAFASLDRWPGTVGEYL
NTVFDPSLTFDDLAWIKSQWPGKLVVKGIQTLDDARAVVDRGVDGIVLSN
HGGRQLDRAPVPFHLLPHVARELGKHTEILVDTGIMSGADIVAAIALGAR
CTLIGRAYLYGLMAGGEAGVNRAIEILQTGVIRTMRLLGVTCLEELSPRH
VTQLRRLGPIGAPT
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)38
MHC class II prediction (Propred)71
MHC class 1 prediction (Propred1)294
CTL epitope prediction (CTLpred)78
Prediction of interferon-gamma inducing peptides (IFNepitope)169
Prediction of IL4 inducing peptides (IL4pred)220