Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433629257
StrainM_canettii_CIPT_140070010
Protein IDYP_007262885.1
Description Putative fatty-acid-coa ligase FadD5 (fatty-acid-CoA synthetase) (f
Sequence MTAQLASHLTRAPTLAQQQPYLARRQNWVNQLERHAMMQPDAPALRFVGN
TMTWADLRRRVAALAGALSGRGVGFGDRVMILMLNRTEFVESVLAANMIG
AIAVPLNFRLTPTEIAVLVEDCAAHVMLTEAALAPVAIGVRDIQPLLSVI
VVAGGSSEDGVFGYEDLLNEAGDVVEPVDIPNDSPALIMYTSGTTGRPKG
AVLTHANLTGQAMTALYTSGANINSDVGFVGVPLFHIAGIGNMLTGLLLG
LPTVIYPLGAFDPGQLLDVLEAEKVTGIFLVPAQWQAVCTEQQARPRDLR
LRVLSWGAAPAPDALLRQMSATFPETQILAAFGQTEMSPVTCMLLGEDAI
AKRGSVGRVIPTVAARVVDQNMNDVPVGEVGEIVYRAPTLMSCYWNNPEA
TAEAFAGGWFHSGDLVRMDSDGYVWVVDRKKDMIISGGENIYCAELENVL
ASHPDIAEVAVIGRADEKWGEVPIAVAAVTNDDLRIEDLGEFLTDRLARY
KHPKALEIVDALPRNPAGKVLKTELRLRYGACVNVERRSVSADFTDRREN
RQRL
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)39
MHC class II prediction (Propred)88
MHC class 1 prediction (Propred1)386
CTL epitope prediction (CTLpred)104
Prediction of interferon-gamma inducing peptides (IFNepitope)235
Prediction of IL4 inducing peptides (IL4pred)333