Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433630095
StrainM_canettii_CIPT_140070010
Protein IDYP_007263723.1
Description Conserved protein of unknown function [Mycobacterium canettii CIPT
Sequence MAESSLNPSLVSRISAFLRPDWTRTVRARRFAAAGLVMLAGVAALRSNPE
DDRAEVVVAAHDLRPGTALTPGDVRLEKRSATTLPDGSQADLGAVVGSTL
ASPTRRGEVLTDVRLLGSRLAESTAGPDARIVPLHLADSALVDLVRVGDV
VDVLAAPVTDSPAALRLLATDAIVVLVSAQQKAQAADSDRVVLVALPARL
ANTVAGAALGQTVTLTLH
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)6
MHC class II prediction (Propred)33
MHC class 1 prediction (Propred1)156
CTL epitope prediction (CTLpred)34
Prediction of interferon-gamma inducing peptides (IFNepitope)75
Prediction of IL4 inducing peptides (IL4pred)92