Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433630464
StrainM_canettii_CIPT_140070010
Protein IDYP_007264092.1
Description Iron import ATP-binding/permease protein IrtA (Iron-regulated trans
Sequence MARGLQGVMLRSFGARDHTATVIETISIAPHFVRVRMVSSTLFQDAEAEP
AAWLRFWFPDPNGSNTEFQRAYTISEADPGAGRFAVDVVLHDPAGPASSW
ARTVKPGATIAVMSLMGSSRFAVPEEQPAGYLLIGDSASIPGMNGIIETV
PDDVPIEMYLEQHDDNDTSIPLAQHPRLRVRWVVRRDEKSLAQAIENRDW
SDWYAWATPEAAALKCVRVRLRDEFGFPKSEIHAQAYWNAGRAMGTHRAT
EPAATEPEVGAAPQPESAVPAPARGSWRAQAASRLLAPLKLPLVLSGVLA
ALVTLAQLAPFVLLVELSRLLVSGAGAHRLFTVGFAAVGLLGTGALLAAA
LTLWLHVIDARFARALRLRLLSKLSRLPLGWFTSRGSGSIKKLVTDDTLA
LHYLVTHAVPDAVAAVVAPVGVLVYLFVVDWRVALVLFGPVLVYLTITSS
LTIQSGPRIVQAQRWAEKMNGEAGSYLEGQPVIRVFGAASSSFRRRLDEY
IGFLVAWQRPLAGKKTLMDLATRPATFLWLIAATGTLLVATHRMDPVNLL
PFMFLGTTFGARLLGIAYGLGGLRTGLLAARHLQVTLDETELAVREHPRQ
PLDGEAPATVVFDHVTFGYRPGVPVIQDVSLTLRPGTVTALVGPSGSGKS
TLATLLARFHDVERGAIHVGGQDIRSLAADELYTRVGFVLQEAQLVHGTA
AENIALAVPDAPAEQVQVAAREAQIHDRVLRLPDGYDTVLGANSGLSGGE
RQRLTIARAILGDTPVLILDEATAFADPESEYLVQQALNRLTRDRTVLVI
AHRLHTITRADQIVVLDHGRIVERGTHEELLAAGGRYCRLWDTGQGSRVA
VAAAQDGTR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)46
MHC class II prediction (Propred)152
MHC class 1 prediction (Propred1)611
CTL epitope prediction (CTLpred)166
Prediction of interferon-gamma inducing peptides (IFNepitope)400
Prediction of IL4 inducing peptides (IL4pred)526