Antigen Card |
The is the antigen card for every antigen and all its information available in our database.
| gene ID | 433630913 |
| Strain | M_canettii_CIPT_140070010 |
| Protein ID | YP_007264541.1 |
| Description | Conserved protein of unknown function- possibly exported [Mycobacte |
| Sequence | MITNLRRRTAMAAAGLGAALGLGILLVPTVDAHLANGSMSEVMMSEIAGL PIPPIIHYGAIAYAPSGASGKAWHQRTPARAEQVALEKCGDKTCKVVSRF TRWGAVAYNGSKYQGGAGLTRRAAEDDAVNRLGGGRIVNWACN |
| B cell epitope (IEDB) | 0 |
| T cell epitope (IEDB) | 1 |
| MHC binder (IEDB) | 1 |
| Vaccine Target | Yes |
| B cell prediction (LBtope) | 22 |
| MHC class II prediction (Propred) | 17 |
| MHC class 1 prediction (Propred1) | 95 |
| CTL epitope prediction (CTLpred) | 20 |
| Prediction of interferon-gamma inducing peptides (IFNepitope) | 87 |
| Prediction of IL4 inducing peptides (IL4pred) | 83 |