Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433631465
StrainM_canettii_CIPT_140070010
Protein IDYP_007265093.1
Description Putative phospholipase C 3 PlcC [Mycobacterium canettii CIPT 140070
Sequence MSRRAFLAKVAGAGAAAALTDWAAPVIEKAYGAGPCSGHLTDIEHIVLCL
QENRSFDHYFGTLSAVDGFDTPTPLFQQKGWNPETQALDPTGITLPYRIN
TTGGPNGVGECVNDPDHQWIAAHLSWNGGANDGWLPAQARTRSVANTPVV
MGYYARPDIPIHYLLADTFTICDQYFSSLLGGTMPNRLYWISATVNPDGD
QGGPQIVEPAIQPKLTFTWRIMPQNLSDAGISWKVYNSKLLGGLNDTSLS
RNGYVGSFKQAADPRSDLVRYGIAPAYPWDFIRDVINNTLPQVSWVVPLT
VESEHPSFPVAVGAVTIVNLIRVLLRNPAVWEKTALIIAYDEHGGFFDHV
TPLTAPEGTPGEWIPNSVDIDKVDGSGGIRGPIGLGFRVPCFVISPYSRG
GLMVHDRFDHTSQLQLIGKRFGVPVPNLTPWRASVTGDMTSAFNFAAPPD
PSPPNLDHPVRQLPKVAKCVPNVVLGFLNEGLPYRVPYPQTTPVQESGPA
RPIPSGIC
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)136
MHC class II prediction (Propred)126
MHC class 1 prediction (Propred1)639
CTL epitope prediction (CTLpred)130
Prediction of interferon-gamma inducing peptides (IFNepitope)353
Prediction of IL4 inducing peptides (IL4pred)699